Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutathione S-transferase P (GSTP1)

Recombinant Human Glutathione S-transferase P (GSTP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GSTP1. Target Synonyms: GST class-piGSTP1-1. Accession Number: P09211. Expression Region: 2~210aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 28.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Glutathione S-transferase P (GSTP1) is a purified Recombinant Protein.

Accession Number

P09211

Expression Region

2~210aa

Host

E. coli

Target

GSTP1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GST class-piGSTP1-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-100 1x 100 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL
BNC880788-100 1x 100 µL

MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3), CF488A conjugate, 0.1mg/mL
BNC880049-100 1x 100 µL

CD31 / PECAM-1 (C31.3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details