Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Abrus precatorius Abrin-a

Recombinant Abrus precatorius Abrin-a is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Abrus precatorius (Indian licorice) (Glycine abrus) . Target Name: Abrus precatorius Abrin-a. Target Synonyms: rRNA N-glycosidase. Accession Number: P11140. Expression Region: 1~251aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 33.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Abrus precatorius Abrin-a is a purified Recombinant Protein.

Accession Number

P11140

Expression Region

1~251aa

Host

E. coli

Target

Abrus precatorius Abrin-a

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

RRNA N-glycosidase

Species

Abrus precatorius (Indian licorice) (Glycine abrus)

Protein Name

Recombinant Protein

AA Sequence

QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Rat IgM, HRP conjugated
orb868956-01 100 µL

Rabbit Anti-Rat IgM, HRP conjugated

Sign In for Pricing
View Details
Rabbit Anti-Rat IgM, HRP conjugated
orb868956-02 1 mL

Rabbit Anti-Rat IgM, HRP conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal CD8 Antibody (2760B) [Janelia Fluor 585]
FAB3804JF585 0.1 mL

Rabbit Monoclonal CD8 Antibody (2760B) [Janelia Fluor 585]

Sign In for Pricing
View Details
Rabbit Anti-Goose IgY (H&L) - HRP
CSA2179-01 100 µL

Rabbit Anti-Goose IgY (H&L) - HRP

Sign In for Pricing
View Details
Rabbit Anti-Goose IgY (H&L) - HRP
CSA2179-02 500 μL

Rabbit Anti-Goose IgY (H&L) - HRP

Sign In for Pricing
View Details
Rabbit Anti-Goose IgY (H&L) - HRP
CSA2179-03 1 mL

Rabbit Anti-Goose IgY (H&L) - HRP

Sign In for Pricing
View Details