Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl)

Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Nrl. Target Synonyms: Nrl; Neural retina-specific leucine zipper protein; NRL. Accession Number: P54846. Expression Region: 1~237aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl) is a purified Recombinant Protein.

Accession Number

P54846

Expression Region

1~237aa

Host

E. coli

Target

Nrl

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nrl; Neural retina-specific leucine zipper protein; NRL

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Calcitonin receptor (Calcr), partial
MBS7054224 Inquire

Recombinant Mouse Calcitonin receptor (Calcr), partial

Sign In for Pricing
View Details
Lentiviral human UBQLN4 shRNA (UAS) - Lentiviral human UBQLN4 shRNA (UAS) plasmid
GTR15115903 1 Vial

Lentiviral human UBQLN4 shRNA (UAS) - Lentiviral human UBQLN4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
LIPI Antibody
A14550-100UG 100 µg

LIPI Antibody

Sign In for Pricing
View Details
KRT6A Antibody, FITC conjugated
A27208-50UG 50 µg

KRT6A Antibody, FITC conjugated

Sign In for Pricing
View Details
UTF1, ID (UTF1, Undifferentiated embryonic cell transcription factor 1) (AP) discontinued
043682-AP 200 µL

UTF1, ID (UTF1, Undifferentiated embryonic cell transcription factor 1) (AP) discontinued

Sign In for Pricing
View Details
RPL19P8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
40971061 1.0 µg DNA

RPL19P8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details