Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl)

Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Nrl. Target Synonyms: Nrl; Neural retina-specific leucine zipper protein; NRL. Accession Number: P54846. Expression Region: 1~237aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl) is a purified Recombinant Protein.

Accession Number

P54846

Expression Region

1~237aa

Host

E. coli

Target

Nrl

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nrl; Neural retina-specific leucine zipper protein; NRL

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SSEA-3/GalGb4 Antibody (2A9)
YP023013-01 50 µg

Anti-SSEA-3/GalGb4 Antibody (2A9)

Sign In for Pricing
View Details
Anti-SSEA-3/GalGb4 Antibody (2A9)
YP023013-02 100 µg

Anti-SSEA-3/GalGb4 Antibody (2A9)

Sign In for Pricing
View Details
Anti-SSEA-3/GalGb4 Antibody (2A9)
YP023013-03 1 mg

Anti-SSEA-3/GalGb4 Antibody (2A9)

Sign In for Pricing
View Details
OR52L1 Protein Vector (Human) (pPM-C-His)
PV107613 500 ng

OR52L1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ATG12 (APG12, APG12L, FBR93, HAPG12, APG12 autophagy 12-like, APG12-like, Apg12 (autophagy, yeast) homolog, autophagy-related protein 12) (PE)
MBS6275940-01 0.2 mL

ATG12 (APG12, APG12L, FBR93, HAPG12, APG12 autophagy 12-like, APG12-like, Apg12 (autophagy, yeast) homolog, autophagy-related protein 12) (PE)

Sign In for Pricing
View Details
ATG12 (APG12, APG12L, FBR93, HAPG12, APG12 autophagy 12-like, APG12-like, Apg12 (autophagy, yeast) homolog, autophagy-related protein 12) (PE)
MBS6275940-02 5x 0.2 mL

ATG12 (APG12, APG12L, FBR93, HAPG12, APG12 autophagy 12-like, APG12-like, Apg12 (autophagy, yeast) homolog, autophagy-related protein 12) (PE)

Sign In for Pricing
View Details