Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2)

Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Spink2. Target Synonyms: Spink2; Serine protease inhibitor Kazal-type 2. Accession Number: Q8BMY7. Expression Region: 17~86aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2) is a purified Recombinant Protein.

Accession Number

Q8BMY7

Expression Region

17~86aa

Host

E. coli

Target

Spink2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Spink2; Serine protease inhibitor Kazal-type 2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-100 1x 100 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-500 1x 500 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-500 1x 500 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
BNC880630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF594 conjugate, 0.1mg/mL
BNC941796-500 1x 500 µL

CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details