Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Group XV phospholipase A2 (Pla2g15)

Recombinant Mouse Group XV phospholipase A2 (Pla2g15) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Pla2g15. Target Synonyms: 1-O-acylceramide synthase1ACSLCAT-like lysophospholipaseLLPLLysophospholipase 3Lysosomal phospholipase A22LPLA2. Accession Number: Q8VEB4. Expression Region: 34~412aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 50.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Group XV phospholipase A2 (Pla2g15) is a purified Recombinant Protein.

Accession Number

Q8VEB4

Expression Region

34~412aa

Host

E. coli

Target

Pla2g15

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1-O-acylceramide synthase1ACSLCAT-like lysophospholipaseLLPLLysophospholipase 3Lysosomal phospholipase A22LPLA2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Hyaluronan Synthase 2 ELISA Kit
MBS107142-01 48 Well

Porcine Hyaluronan Synthase 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Hyaluronan Synthase 2 ELISA Kit
MBS107142-02 96 Well

Porcine Hyaluronan Synthase 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Hyaluronan Synthase 2 ELISA Kit
MBS107142-03 5x 96 Well

Porcine Hyaluronan Synthase 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Hyaluronan Synthase 2 ELISA Kit
MBS107142-04 10x 96 Well

Porcine Hyaluronan Synthase 2 ELISA Kit

Sign In for Pricing
View Details
Stk38l sgRNA CRISPR Lentivector set (Rat)
K6385601 3x 1.0 µg

Stk38l sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal CD8 Antibody (UCH-T4) [FITC]
NBP2-50468F 0.1 mL

Mouse Monoclonal CD8 Antibody (UCH-T4) [FITC]

Sign In for Pricing
View Details