Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1)

Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) . Target Name: PRA1. Target Synonyms: 58 kDa fibrinogen-binding mannoproteinFBP1. Accession Number: P87020. Expression Region: 16~299aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1) is a purified Recombinant Protein.

Accession Number

P87020

Expression Region

16~299aa

Host

Yeast

Target

PRA1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

58 kDa fibrinogen-binding mannoproteinFBP1

Species

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Protein Name

Recombinant Protein

AA Sequence

APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASSSHQHTDSNPSATTDANSHCHTHADGEVHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BARHL2 Protein Vector (Human) (pPM-C-His)
PV049232 500 ng

BARHL2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PTMA, NT (PTMA, TMSA, Prothymosin alpha, Thymosin alpha-1) (PE)
MBS6338853-01 0.2 mL

PTMA, NT (PTMA, TMSA, Prothymosin alpha, Thymosin alpha-1) (PE)

Sign In for Pricing
View Details
PTMA, NT (PTMA, TMSA, Prothymosin alpha, Thymosin alpha-1) (PE)
MBS6338853-02 5x 0.2 mL

PTMA, NT (PTMA, TMSA, Prothymosin alpha, Thymosin alpha-1) (PE)

Sign In for Pricing
View Details
Werner syndrome RecQ helicase-IN-4
MBS5814605 Inquire

Werner syndrome RecQ helicase-IN-4

Sign In for Pricing
View Details
IKK Control Peptide
I3000-04B 50 µg

IKK Control Peptide

Sign In for Pricing
View Details
Anti-CTNNB1 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)
A134262 100 µL

Anti-CTNNB1 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)

Sign In for Pricing
View Details