Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD63 antigen (CD63), partial

Recombinant Human CD63 antigen (CD63), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD63. Target Synonyms: GranulophysinLysosomal-associated membrane protein 3LAMP-3Melanoma-associated antigen ME491OMA81HOcular melanoma-associated antigenTetraspanin-30Tspan-30CD_antigen: CD63MLA1, TSPAN30. Accession Number: P08962. Expression Region: 103~203aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human CD63 antigen (CD63), partial is a purified Recombinant Protein.

Accession Number

P08962

Expression Region

103~203aa

Host

Yeast

Target

CD63

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GranulophysinLysosomal-associated membrane protein 3LAMP-3Melanoma-associated antigen ME491OMA81HOcular melanoma-associated antigenTetraspanin-30Tspan-30CD_antigen: CD63MLA1, TSPAN30

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPXV A29L Antibody
E55A12742 100 µg

MPXV A29L Antibody

Sign In for Pricing
View Details
MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase) (PE)
MBS6385059-01 0.1 mL

MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase) (PE)

Sign In for Pricing
View Details
MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase) (PE)
MBS6385059-02 5x 0.1 mL

MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase) (PE)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) ILVC Polyclonal Antibody
MBS7184719 Inquire

Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) ILVC Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Entr1 shRNA (UAS) - Lentiviral mouse Entr1 shRNA (UAS, iRFP) (100)
GTR15271383 1 Vial

Lentiviral mouse Entr1 shRNA (UAS) - Lentiviral mouse Entr1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Olfr1333 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4219803 1.0 µg DNA

Olfr1333 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details