Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CCN family member 2 (CCN2), partial

Recombinant Human CCN family member 2 (CCN2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CCN2. Target Synonyms: CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8; IBP-8; IGF-binding protein 8; IGFBP-8. Accession Number: P29279. Expression Region: 253~349aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 15.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human CCN family member 2 (CCN2), partial is a purified Recombinant Protein.

Accession Number

P29279

Expression Region

253~349aa

Host

E. coli

Target

CCN2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8; IBP-8; IGF-binding protein 8; IGFBP-8

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details