Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial

Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: CCL2. Target Synonyms: HC11Monocyte chemoattractant protein 1Monocyte chemotactic and activating factor; MCAFMonocyte chemotactic protein 1; MCP-1Monocyte secretory protein JESmall-inducible cytokine A2. Accession Number: P10148. Expression Region: 24~96aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 12.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial is a purified Recombinant Protein.

Accession Number

P10148

Expression Region

24~96aa

Host

E. coli

Target

CCL2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

HC11Monocyte chemoattractant protein 1Monocyte chemotactic and activating factor; MCAFMonocyte chemotactic protein 1; MCP-1Monocyte secretory protein JESmall-inducible cytokine A2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Semaphorin 3A (SEMA3A) ELISA Kit
GTR10319435 96 Well

Porcine Semaphorin 3A (SEMA3A) ELISA Kit

Sign In for Pricing
View Details
ACAT2 (Acetyl-CoA Acetyltransferase, Cytosolic, Cytosolic Acetoacetyl-CoA Thiolase, Acetyl-CoA Transferase-like Protein, ACTL) (MaxLight 405) discontinued
122861-ML405 100 µL

ACAT2 (Acetyl-CoA Acetyltransferase, Cytosolic, Cytosolic Acetoacetyl-CoA Thiolase, Acetyl-CoA Transferase-like Protein, ACTL) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Histone H3 (mono methyl K9) Monoclonal Antibody, PerCP-Cy5.5 Conjugated
bsm-33116M-PerCP-Cy5.5 100 µL

Histone H3 (mono methyl K9) Monoclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Unkl (NM_001290736) Mouse Untagged Clone
MC228236 10 µg

Unkl (NM_001290736) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Fumarate reductase subunit C (frdC)
orb2932692-01 20 µg

Recombinant Salmonella choleraesuis Fumarate reductase subunit C (frdC)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Fumarate reductase subunit C (frdC)
orb2932692-02 100 µg

Recombinant Salmonella choleraesuis Fumarate reductase subunit C (frdC)

Sign In for Pricing
View Details