Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial

Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: CCL2. Target Synonyms: HC11Monocyte chemoattractant protein 1Monocyte chemotactic and activating factor; MCAFMonocyte chemotactic protein 1; MCP-1Monocyte secretory protein JESmall-inducible cytokine A2. Accession Number: P10148. Expression Region: 24~96aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 12.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial is a purified Recombinant Protein.

Accession Number

P10148

Expression Region

24~96aa

Host

E. coli

Target

CCL2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

HC11Monocyte chemoattractant protein 1Monocyte chemotactic and activating factor; MCAFMonocyte chemotactic protein 1; MCP-1Monocyte secretory protein JESmall-inducible cytokine A2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gliocidin
E5804-100mg 100 mg

Gliocidin

Sign In for Pricing
View Details
SFRS8, NT (SFSWAP, SFRS8, SWAP, Splicing factor, suppressor of white-apricot homolog, Splicing factor, arginine/serine-rich 8, Suppressor of white apricot protein homolog) (MaxLight 550) discontinued
041635-ML550 100 µL

SFRS8, NT (SFSWAP, SFRS8, SWAP, Splicing factor, suppressor of white-apricot homolog, Splicing factor, arginine/serine-rich 8, Suppressor of white apricot protein homolog) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Saint Louis Encephalitis Virus (SLEV-NS1) Antibody
MBS569806-01 1 mg

Saint Louis Encephalitis Virus (SLEV-NS1) Antibody

Sign In for Pricing
View Details
Saint Louis Encephalitis Virus (SLEV-NS1) Antibody
MBS569806-02 5x 1 mg

Saint Louis Encephalitis Virus (SLEV-NS1) Antibody

Sign In for Pricing
View Details
Heat Shock Protein 75 kDa , Mitochondrial (Trap1) Antibody (ATTO 633)
abx441203 100 µg

Heat Shock Protein 75 kDa , Mitochondrial (Trap1) Antibody (ATTO 633)

Sign In for Pricing
View Details
UBE2L3 AAV Vector (Mouse) (CMV)
48981104 1 µg

UBE2L3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details