Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A14 (S100A14)

Recombinant Human Protein S100-A14 (S100A14) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: S100A14. Target Synonyms: S100 calcium-binding protein A14S114S100A15. Accession Number: Q9HCY8. Expression Region: 1~104aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein S100-A14 (S100A14) is a purified Recombinant Protein.

Accession Number

Q9HCY8

Expression Region

1~104aa

Host

Yeast

Target

S100A14

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

S100 calcium-binding protein A14S114S100A15

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kir2.2 (KCNJ12) (NM_021012) Human Tagged Lenti ORF Clone
RC207051L4 10 µg

Kir2.2 (KCNJ12) (NM_021012) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)
MBS1153468-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)
MBS1153468-02 0.1 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)
MBS1153468-03 0.02 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)
MBS1153468-04 0.1 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)
MBS1153468-05 0.02 mg (Baculovirus)

Recombinant Buchnera aphidicola subsp. Cinara cedri UPF0133 protein BCc_301 (BCc_301)

Sign In for Pricing
View Details