Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2)

Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SLURP2. Target Synonyms: Secreted LY6/PLAUR domain-containing protein 2Secreted Ly-6/uPAR-related protein 2. Accession Number: P0DP57. Expression Region: 23~97aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2) is a purified Recombinant Protein.

Accession Number

P0DP57

Expression Region

23~97aa

Host

Yeast

Target

SLURP2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Secreted LY6/PLAUR domain-containing protein 2Secreted Ly-6/uPAR-related protein 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-500 1x 500 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-100 1x 100 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details