Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus kawachii Probable endo-beta-1, 4-glucanase D (eglD)

Recombinant Aspergillus kawachii Probable endo-beta-1, 4-glucanase D (eglD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Aspergillus kawachii (strain NBRC 4308) . Target Name: eglD. Target Synonyms: Carboxymethylcellulase DCellulase 61ACellulase Dcel61A. Accession Number: Q96WQ9. Expression Region: 21~408aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 55.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Aspergillus kawachii Probable endo-beta-1, 4-glucanase D (eglD) is a purified Recombinant Protein.

Accession Number

Q96WQ9

Expression Region

21~408aa

Host

Yeast

Target

EglD

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumostar-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

55.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Carboxymethylcellulase DCellulase 61ACellulase Dcel61A

Species

Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)

Protein Name

Recombinant Protein

AA Sequence

HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 Antibody
GWB-D3A380 0.1 mg

p53 Antibody

Sign In for Pricing
View Details
Chicken anti-gastric parietal cell antibody, AGPA/PCA ELISA Kit
MBS7200379-01 48 Well

Chicken anti-gastric parietal cell antibody, AGPA/PCA ELISA Kit

Sign In for Pricing
View Details
Chicken anti-gastric parietal cell antibody, AGPA/PCA ELISA Kit
MBS7200379-02 96 Well

Chicken anti-gastric parietal cell antibody, AGPA/PCA ELISA Kit

Sign In for Pricing
View Details
Chicken anti-gastric parietal cell antibody, AGPA/PCA ELISA Kit
MBS7200379-03 5x 96 Well

Chicken anti-gastric parietal cell antibody, AGPA/PCA ELISA Kit

Sign In for Pricing
View Details
Chicken anti-gastric parietal cell antibody, AGPA/PCA ELISA Kit
MBS7200379-04 10x 96 Well

Chicken anti-gastric parietal cell antibody, AGPA/PCA ELISA Kit

Sign In for Pricing
View Details
HIST1H1D siRNA (Mouse)
MBS8222915-01 15 nmol

HIST1H1D siRNA (Mouse)

Sign In for Pricing
View Details