Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus kawachii Probable endo-beta-1, 4-glucanase D (eglD)

Recombinant Aspergillus kawachii Probable endo-beta-1, 4-glucanase D (eglD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Aspergillus kawachii (strain NBRC 4308) . Target Name: eglD. Target Synonyms: Carboxymethylcellulase DCellulase 61ACellulase Dcel61A. Accession Number: Q96WQ9. Expression Region: 21~408aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 55.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Aspergillus kawachii Probable endo-beta-1, 4-glucanase D (eglD) is a purified Recombinant Protein.

Accession Number

Q96WQ9

Expression Region

21~408aa

Host

Yeast

Target

EglD

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumostar-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

55.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Carboxymethylcellulase DCellulase 61ACellulase Dcel61A

Species

Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)

Protein Name

Recombinant Protein

AA Sequence

HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HACE1 Rabbit Polyclonal Antibody
E53P09116 100 µL

HACE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ppp1r18 (NM_001146710) Mouse Tagged ORF Clone Lentiviral Particle
MR217958L3V 200 µL

Ppp1r18 (NM_001146710) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lypd5 3'UTR GFP Stable Cell Line
TU162742 1.0 mL

Lypd5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Jam2 (NM_001034004) Rat Tagged ORF Clone Lentiviral Particle
RR211130L3V 200 µL

Jam2 (NM_001034004) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sodium Potassium ATPase (ATP1A1) (NM_000701) Human 3' UTR Clone
SC204589 10 µg

Sodium Potassium ATPase (ATP1A1) (NM_000701) Human 3' UTR Clone

Sign In for Pricing
View Details
4-Hydroxy-5-methoxyisophthalaldehyde (Standard)
HY-W112784R 1 Each

4-Hydroxy-5-methoxyisophthalaldehyde (Standard)

Sign In for Pricing
View Details