Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human COP9 signalosome complex subunit 2 (COPS2)

Recombinant Human COP9 signalosome complex subunit 2 (COPS2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COPS2. Target Synonyms: Alien homologJAB1-containing signalosome subunit 2Thyroid receptor-interacting protein 15. Accession Number: P61201. Expression Region: 1~443aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 53.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human COP9 signalosome complex subunit 2 (COPS2) is a purified Recombinant Protein.

Accession Number

P61201

Expression Region

1~443aa

Host

Yeast

Target

COPS2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Alien homologJAB1-containing signalosome subunit 2Thyroid receptor-interacting protein 15

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Serpinb6a shRNA (UAS) - Lentiviral mouse Serpinb6a shRNA (UAS) (100)
GTR15232758 1 Vial

Lentiviral mouse Serpinb6a shRNA (UAS) - Lentiviral mouse Serpinb6a shRNA (UAS) (100)

Sign In for Pricing
View Details
YIF1B Protein Vector (Mouse) (pPM-C-HA)
PV248016 500 ng

YIF1B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-SDHA Rabbit Monoclonal Antibody
M01753-2-20μl 20 µL

Anti-SDHA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Ppan 3'UTR Lenti-reporter-Luc Vector
37287086 1.0 µg

Ppan 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SLC39A1 (Zinc Transporter ZIP1, Solute Carrier Family 39 Member 1, Zinc-iron-regulated Transporter-like, Zrt- and Irt-like Protein 1, ZIP-1, hZIP1, IRT1, ZIP1, ZIRTL, CGI-08, CGI-71)
146765 100 µg

SLC39A1 (Zinc Transporter ZIP1, Solute Carrier Family 39 Member 1, Zinc-iron-regulated Transporter-like, Zrt- and Irt-like Protein 1, ZIP-1, hZIP1, IRT1, ZIP1, ZIRTL, CGI-08, CGI-71)

Sign In for Pricing
View Details
Mouse Cyclin L2 (CCNL2) ELISA Kit
GTR10314375 96 Well

Mouse Cyclin L2 (CCNL2) ELISA Kit

Sign In for Pricing
View Details