Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human COP9 signalosome complex subunit 2 (COPS2)

Recombinant Human COP9 signalosome complex subunit 2 (COPS2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COPS2. Target Synonyms: Alien homologJAB1-containing signalosome subunit 2Thyroid receptor-interacting protein 15. Accession Number: P61201. Expression Region: 1~443aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 53.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human COP9 signalosome complex subunit 2 (COPS2) is a purified Recombinant Protein.

Accession Number

P61201

Expression Region

1~443aa

Host

Yeast

Target

COPS2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Alien homologJAB1-containing signalosome subunit 2Thyroid receptor-interacting protein 15

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krt19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
26001114 3x 1.0 µg

Krt19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Apobr sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4695602 1.0 µg DNA

Apobr sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Gm3646 (NM_001177348) Mouse Tagged ORF Clone Lentiviral Particle
MR219531L4V 200 µL

Gm3646 (NM_001177348) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SH2D1B Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV714985 1.0 µg DNA

SH2D1B Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
AU019823 (NM_212449) Mouse Tagged Lenti ORF Clone
MR203469L4 10 µg

AU019823 (NM_212449) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ERLIN1, ID (ERLIN1, C10orf69, KE04, KEO4, SPFH1, Erlin-1, Endoplasmic reticulum lipid raft-associated protein 1, Protein KE04, Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1) (Biotin) discontinued
035210-Biotin 200 µL

ERLIN1, ID (ERLIN1, C10orf69, KE04, KEO4, SPFH1, Erlin-1, Endoplasmic reticulum lipid raft-associated protein 1, Protein KE04, Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1) (Biotin) discontinued

Sign In for Pricing
View Details