Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus X Outer capsid protein VP4

Recombinant Rotavirus X Outer capsid protein VP4 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219) ) . Target Name: Rotavirus X Outer capsid protein VP4. Target Synonyms: Hemagglutinin. Accession Number: A9Q1L0. Expression Region: 1~249aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 30.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rotavirus X Outer capsid protein VP4 is a purified Recombinant Protein.

Accession Number

A9Q1L0

Expression Region

1~249aa

Host

Yeast

Target

Rotavirus X Outer capsid protein VP4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hemagglutinin

Species

Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219) )

Protein Name

Recombinant Protein

AA Sequence

MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)
MBS1254860-01 0.02 mg (E-Coli)

Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)

Sign In for Pricing
View Details
Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)
MBS1254860-02 0.02 mg (Yeast)

Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)

Sign In for Pricing
View Details
Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)
MBS1254860-03 0.1 mg (E-Coli)

Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)

Sign In for Pricing
View Details
Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)
MBS1254860-04 0.1 mg (Yeast)

Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)

Sign In for Pricing
View Details
Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)
MBS1254860-05 0.02 mg (Baculovirus)

Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)

Sign In for Pricing
View Details
Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)
MBS1254860-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse WD repeat and SOCS box-containing protein 1 (Wsb1)

Sign In for Pricing
View Details