Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Odorant-binding protein

Recombinant Bovine Odorant-binding protein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: Bovine Odorant-binding protein. Target Synonyms: Olfactory mucosa pyrazine-binding protein. Accession Number: P07435. Expression Region: 1~159aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bovine Odorant-binding protein is a purified Recombinant Protein.

Accession Number

P07435

Expression Region

1~159aa

Host

Yeast

Target

Bovine Odorant-binding protein

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Olfactory mucosa pyrazine-binding protein

Species

Bovine (Bos taurus)

Protein Name

Recombinant Protein

AA Sequence

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (3-Fluorophenoxy) pyrrolidine hydrochloride
sc-311785 500 mg

3- (3-Fluorophenoxy) pyrrolidine hydrochloride

Sign In for Pricing
View Details
DCP1B (NM_152640) Human Tagged Lenti ORF Clone
RC207398L2 10 µg

DCP1B (NM_152640) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human LIN37 Protein
E30P9106 20 µg

Recombinant Human LIN37 Protein

Sign In for Pricing
View Details
Recombinant Cellvibrio japonicus 8-amino-7-oxononanoate synthase (bioF)
MBS1259881-01 0.02 mg (E-Coli)

Recombinant Cellvibrio japonicus 8-amino-7-oxononanoate synthase (bioF)

Sign In for Pricing
View Details
Recombinant Cellvibrio japonicus 8-amino-7-oxononanoate synthase (bioF)
MBS1259881-02 0.02 mg (Yeast)

Recombinant Cellvibrio japonicus 8-amino-7-oxononanoate synthase (bioF)

Sign In for Pricing
View Details
Recombinant Cellvibrio japonicus 8-amino-7-oxononanoate synthase (bioF)
MBS1259881-03 0.1 mg (E-Coli)

Recombinant Cellvibrio japonicus 8-amino-7-oxononanoate synthase (bioF)

Sign In for Pricing
View Details