Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Centruroides noxius Beta-mammal toxin Cn2

Recombinant Centruroides noxius Beta-mammal toxin Cn2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Centruroides noxius (Mexican scorpion) . Target Name: Centruroides noxius Beta-mammal toxin Cn2. Target Synonyms: Toxin II.9.2.2. Accession Number: P01495. Expression Region: 17~82aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 9.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Centruroides noxius Beta-mammal toxin Cn2 is a purified Recombinant Protein.

Accession Number

P01495

Expression Region

17~82aa

Host

Yeast

Target

Centruroides noxius Beta-mammal toxin Cn2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

9.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Toxin II.9.2.2

Species

Centruroides noxius (Mexican scorpion)

Protein Name

Recombinant Protein

AA Sequence

KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PIM1 Pre-designed siRNA Set B
SI012194B 1 Each

Human PIM1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
APOA1BP Peptide
46-801P 0.1 mg

APOA1BP Peptide

Sign In for Pricing
View Details
Easypro Rat Pentraxin 3 (PTX-3/TSG-14) ELISA Kit
FY-ER3525S 96 Well

Easypro Rat Pentraxin 3 (PTX-3/TSG-14) ELISA Kit

Sign In for Pricing
View Details
Bcl 2 (B Cell Leukemia 2, B Cell Leukemia/lymphoma 2, B Cell Lymphoma 2, B Cell CLL/lymphoma 2, Bcl2, Bcl-2 Protein, Apoptosis Regulator Bcl 2, Apoptosis Regulator Bcl2) (Not for Export EU)
B0807-03V 50 µL

Bcl 2 (B Cell Leukemia 2, B Cell Leukemia/lymphoma 2, B Cell Lymphoma 2, B Cell CLL/lymphoma 2, Bcl2, Bcl-2 Protein, Apoptosis Regulator Bcl 2, Apoptosis Regulator Bcl2) (Not for Export EU)

Sign In for Pricing
View Details
TMEM55A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
47066111 3x 1.0 µg

TMEM55A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD41 Antibody[HIP8]
FCE2155-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD41 Antibody[HIP8]

Sign In for Pricing
View Details