Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human rhinovirus 1A Genome polyprotein

Recombinant Human rhinovirus 1A Genome polyprotein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human rhinovirus 1A (HRV-1A) . Target Name: Human rhinovirus 1A Genome polyprotein. Target Synonyms: Genome polyprotein; Cleaved into: P1; Capsid protein VP0; VP4-VP2; Capsid protein VP4; P1A; Virion protein 4; Capsid protein VP2; P1B; Virion protein 2; Capsid protein VP3; P1C; Virion protein 3; Capsid protein VP1; P1D; Virion protein 1. Accession Number: P23008. Expression Region: 571~857aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 34.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human rhinovirus 1A Genome polyprotein is a purified Recombinant Protein.

Accession Number

P23008

Expression Region

571~857aa

Host

Yeast

Target

Human rhinovirus 1A Genome polyprotein

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Genome polyprotein; Cleaved into: P1; Capsid protein VP0; VP4-VP2; Capsid protein VP4; P1A; Virion protein 4; Capsid protein VP2; P1B; Virion protein 2; Capsid protein VP3; P1C; Virion protein 3; Capsid protein VP1; P1D; Virion protein 1; P2; Protease 2A; P2A; EC 3.4.22.29; Picornain 2A; Protein 2A; Protein 2B; P2B; Protein 2C; P2C; EC 3.6.1.15; P3; Protein 3AB; Protein 3A; P3A; Viral protein genome-linked; VPg; Protein 3B; P3B; Protein 3CD; EC 3.4.22.28; Protease 3C; EC 3.4.22.28; Picornain 3C; P3C; RNA-directed RNA polymerase; RdRp; EC 2.7.7.48; 3D polymerase; 3Dpol; Protein 3D; 3D

Species

Human rhinovirus 1A (HRV-1A)

Protein Name

Recombinant Protein

AA Sequence

NPVENYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKHSVVITTHIYHKAKHTKAWCPRPPRAVPYTHSHVTNYMPETGDVTTAIVRRNTITTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIGD1C CRISPR Activation Plasmid (h2)
sc-416093-ACT-2 20 µg

HIGD1C CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
SCN11A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV673317 1.0 µg DNA

SCN11A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
BCAT2 Rabbit Polyclonal Antibody
MBS9466241-01 0.05 mL

BCAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCAT2 Rabbit Polyclonal Antibody
MBS9466241-02 0.1 mL

BCAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCAT2 Rabbit Polyclonal Antibody
MBS9466241-03 5x 0.1 mL

BCAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STK24 Antibody
orb2684234-01 50 µL

STK24 Antibody

Sign In for Pricing
View Details