Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis P6 virus KP6 killer toxin

Recombinant Ustilago maydis P6 virus KP6 killer toxin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ustilago maydis P6 virus (UmV6) (UmV-P6) . Target Name: Ustilago maydis P6 virus KP6 killer toxin. Target Synonyms: KP6 killer toxin; Killer protein 6; Cleaved into: KP6 killer toxin subunit alpha; VP10; KP6 killer toxin subunit beta; VP12.5. Accession Number: P16948. Expression Region: 28~105aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Ustilago maydis P6 virus KP6 killer toxin is a purified Recombinant Protein.

Accession Number

P16948

Expression Region

28~105aa

Host

Yeast

Target

Ustilago maydis P6 virus KP6 killer toxin

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

KP6 killer toxin; Killer protein 6; Cleaved into: KP6 killer toxin subunit alpha; VP10; KP6 killer toxin subunit beta; VP12.5

Species

Ustilago maydis P6 virus (UmV6) (UmV-P6)

Protein Name

Recombinant Protein

AA Sequence

NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal TSPAN1 Antibody (010) [mFluor Violet 450 SE]
NBP2-90167MFV450 0.1 mL

Rabbit Monoclonal TSPAN1 Antibody (010) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TTC32 Antibody
OACA04895-100UG 100 µg

TTC32 Antibody

Sign In for Pricing
View Details
Anti - Connexin 31.1 (CX31.1.1, Gap Junction Beta 5 Protein, CXB-5)
MBS612273-01 0.1 mL

Anti - Connexin 31.1 (CX31.1.1, Gap Junction Beta 5 Protein, CXB-5)

Sign In for Pricing
View Details
Anti - Connexin 31.1 (CX31.1.1, Gap Junction Beta 5 Protein, CXB-5)
MBS612273-02 5x 0.1 mL

Anti - Connexin 31.1 (CX31.1.1, Gap Junction Beta 5 Protein, CXB-5)

Sign In for Pricing
View Details
Olfactory receptor 5AR1 Antibody
OM635498-01 100 µL

Olfactory receptor 5AR1 Antibody

Sign In for Pricing
View Details
Olfactory receptor 5AR1 Antibody
OM635498-02 20 µL

Olfactory receptor 5AR1 Antibody

Sign In for Pricing
View Details