Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis P6 virus KP6 killer toxin

Recombinant Ustilago maydis P6 virus KP6 killer toxin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ustilago maydis P6 virus (UmV6) (UmV-P6) . Target Name: Ustilago maydis P6 virus KP6 killer toxin. Target Synonyms: KP6 killer toxin; Killer protein 6; Cleaved into: KP6 killer toxin subunit alpha; VP10; KP6 killer toxin subunit beta; VP12.5. Accession Number: P16948. Expression Region: 28~105aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Ustilago maydis P6 virus KP6 killer toxin is a purified Recombinant Protein.

Accession Number

P16948

Expression Region

28~105aa

Host

Yeast

Target

Ustilago maydis P6 virus KP6 killer toxin

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

KP6 killer toxin; Killer protein 6; Cleaved into: KP6 killer toxin subunit alpha; VP10; KP6 killer toxin subunit beta; VP12.5

Species

Ustilago maydis P6 virus (UmV6) (UmV-P6)

Protein Name

Recombinant Protein

AA Sequence

NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal TROP-2 Antibody (TACSTD2/7349R) [Alexa Fluor 405]
NBP3-24007AF405 0.1 mL

Rabbit Monoclonal TROP-2 Antibody (TACSTD2/7349R) [Alexa Fluor 405]

Sign In for Pricing
View Details
Eotaxin-2 (C-C Motif Chemokine 24, CK-beta-6, Eosinophil Chemotactic Protein 2, CCL24, Myeloid Progenitor Inhibitory Factor 2, MPIF-2, Small-inducible Cytokine A24, MPIF2, SCYA24) (PE) discontinued
143572-PE 100 µL

Eotaxin-2 (C-C Motif Chemokine 24, CK-beta-6, Eosinophil Chemotactic Protein 2, CCL24, Myeloid Progenitor Inhibitory Factor 2, MPIF-2, Small-inducible Cytokine A24, MPIF2, SCYA24) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Human WWP2 Protein, N-His
orb2830929-01 20 µg

Recombinant Human WWP2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human WWP2 Protein, N-His
orb2830929-02 50 µg

Recombinant Human WWP2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human WWP2 Protein, N-His
orb2830929-03 100 µg

Recombinant Human WWP2 Protein, N-His

Sign In for Pricing
View Details
CMG1 (IFT74) (NM_001099222) Human Tagged ORF Clone Lentiviral Particle
RC212777L4V 200 µL

CMG1 (IFT74) (NM_001099222) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details