Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max 2S seed storage albumin protein

Recombinant Glycine max 2S seed storage albumin protein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Glycine max (Soybean) (Glycine hispida) . Target Name: Glycine max 2S seed storage albumin protein. Target Synonyms: 2S albumin; GM2S-1; Napin-type 2S albumin 3; Cleaved into: 2S albumin small chain; Aspartic acid-rich peptide; Lunasin; 2S albumin large chain; 8 kDa methionine-rich protein; 8 kDa MRP. Accession Number: P19594. Expression Region: 22~158aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Glycine max 2S seed storage albumin protein is a purified Recombinant Protein.

Accession Number

P19594

Expression Region

22~158aa

Host

Yeast

Target

Glycine max 2S seed storage albumin protein

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

2S albumin; GM2S-1; Napin-type 2S albumin 3; Cleaved into: 2S albumin small chain; Aspartic acid-rich peptide; Lunasin; 2S albumin large chain; 8 kDa methionine-rich protein; 8 kDa MRP

Species

Glycine max (Soybean) (Glycine hispida)

Protein Name

Recombinant Protein

AA Sequence

SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Salusin α (Salusin Alpha) ValidElisa Kit
EK341965 96 Well

Human Salusin α (Salusin Alpha) ValidElisa Kit

Ask
View Details
TIM-1 (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) (MaxLight 490)
MBS6502636-01 0.1 mL

TIM-1 (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) (MaxLight 490)

Ask
View Details
TIM-1 (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) (MaxLight 490)
MBS6502636-02 5x 0.1 mL

TIM-1 (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) (MaxLight 490)

Ask
View Details
Rhizochalinin
MBS5822931 Inquire

Rhizochalinin

Ask
View Details
L520 Serum-Free Medium for Lymphocyte
6811071 2 L

L520 Serum-Free Medium for Lymphocyte

Ask
View Details
LRRC14B (N-Term) Rabbit pAb
MBS8553303-01 0.1 mL

LRRC14B (N-Term) Rabbit pAb

Ask
View Details