Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein K3 (VACWR034)

Recombinant Vaccinia virus Protein K3 (VACWR034) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) ) . Target Name: VACWR034. Target Synonyms: Protein K2. Accession Number: P18378. Expression Region: 1~88aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 12.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Vaccinia virus Protein K3 (VACWR034) is a purified Recombinant Protein.

Accession Number

P18378

Expression Region

1~88aa

Host

Yeast

Target

VACWR034

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein K2

Species

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Protein Name

Recombinant Protein

AA Sequence

MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF684 Lentiviral Activation Particles (h)
sc-414301-LAC 200 µL

ZNF684 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Diclofenac potassium
412436 50.0mg

Diclofenac potassium

Sign In for Pricing
View Details
SAP18 (Histone Deacetylase Complex subunit SAP18, 18kD Sin3-associated Polypeptide, SAP18P, 2HOR0202) (HRP)
MBS6436697-01 0.1 mL

SAP18 (Histone Deacetylase Complex subunit SAP18, 18kD Sin3-associated Polypeptide, SAP18P, 2HOR0202) (HRP)

Sign In for Pricing
View Details
SAP18 (Histone Deacetylase Complex subunit SAP18, 18kD Sin3-associated Polypeptide, SAP18P, 2HOR0202) (HRP)
MBS6436697-02 5x 0.1 mL

SAP18 (Histone Deacetylase Complex subunit SAP18, 18kD Sin3-associated Polypeptide, SAP18P, 2HOR0202) (HRP)

Sign In for Pricing
View Details
Mylk4 (NM_001166030) Mouse Tagged ORF Clone Lentiviral Particle
MR224917L4V 200 µL

Mylk4 (NM_001166030) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PCDHB15 siRNA (Human)
CRJ1065-01 15 nmol

PCDHB15 siRNA (Human)

Sign In for Pricing
View Details