Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synsepalum dulcificum Miraculin

Recombinant Synsepalum dulcificum Miraculin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica) . Target Name: Synsepalum dulcificum Miraculin. Target Synonyms: Miraculin; MIR. Accession Number: P13087. Expression Region: 30~220aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Synsepalum dulcificum Miraculin is a purified Recombinant Protein.

Accession Number

P13087

Expression Region

30~220aa

Host

Yeast

Target

Synsepalum dulcificum Miraculin

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Miraculin; MIR

Species

Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica)

Protein Name

Recombinant Protein

AA Sequence

DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPLA2 rabbit pAb Antibody
orb766781-01 50 μL

CPLA2 rabbit pAb Antibody

Sign In for Pricing
View Details
CPLA2 rabbit pAb Antibody
orb766781-02 100 µL

CPLA2 rabbit pAb Antibody

Sign In for Pricing
View Details
Galnt1 3'UTR Luciferase Stable Cell Line
TU204922 1.0 mL

Galnt1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Carbohydrate Antigen 125 (CA125) ELISA Kit
MBS2021725-01 24 Strip Well

Mouse Carbohydrate Antigen 125 (CA125) ELISA Kit

Sign In for Pricing
View Details
Mouse Carbohydrate Antigen 125 (CA125) ELISA Kit
MBS2021725-02 48 Well

Mouse Carbohydrate Antigen 125 (CA125) ELISA Kit

Sign In for Pricing
View Details
Mouse Carbohydrate Antigen 125 (CA125) ELISA Kit
MBS2021725-03 96 Well

Mouse Carbohydrate Antigen 125 (CA125) ELISA Kit

Sign In for Pricing
View Details