Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trypsin-4 (Try4)

Recombinant Rat Trypsin-4 (Try4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Try4. Target Synonyms: Pretrypsinogen IVTrypsin IV. Accession Number: P12788. Expression Region: 24~247aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 40.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Trypsin-4 (Try4) is a purified Recombinant Protein.

Accession Number

P12788

Expression Region

24~247aa

Host

Yeast

Target

Try4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumostar-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pretrypsinogen IVTrypsin IV

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARG siRNA (Rat)
CRR6501-01 15 nmol

SARG siRNA (Rat)

Sign In for Pricing
View Details
SARG siRNA (Rat)
CRR6501-02 30 nmol

SARG siRNA (Rat)

Sign In for Pricing
View Details
IL32 Rabbit Polyclonal Antibody (BF350)
orb2435853 100 µL

IL32 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Human C-Type Lectin Domain Family 7, Member A (CLEC7A) ELISA Kit
MBS2706926-01 24 Strip Well

Human C-Type Lectin Domain Family 7, Member A (CLEC7A) ELISA Kit

Sign In for Pricing
View Details
Human C-Type Lectin Domain Family 7, Member A (CLEC7A) ELISA Kit
MBS2706926-02 48 Well

Human C-Type Lectin Domain Family 7, Member A (CLEC7A) ELISA Kit

Sign In for Pricing
View Details
Human C-Type Lectin Domain Family 7, Member A (CLEC7A) ELISA Kit
MBS2706926-03 96 Well

Human C-Type Lectin Domain Family 7, Member A (CLEC7A) ELISA Kit

Sign In for Pricing
View Details