Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6C1 (Ly6c1)

Recombinant Mouse Lymphocyte antigen 6C1 (Ly6c1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ly6c1. Target Synonyms: Ly6c1; Lymphocyte antigen 6C1; Ly-6C1. Accession Number: P0CW02. Expression Region: 27~109aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 25.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Lymphocyte antigen 6C1 (Ly6c1) is a purified Recombinant Protein.

Accession Number

P0CW02

Expression Region

27~109aa

Host

Yeast

Target

Ly6c1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumostar-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ly6c1; Lymphocyte antigen 6C1; Ly-6C1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human P4HB Protein, N-His
HY517022-01 50 µg

Recombinant Human P4HB Protein, N-His

Sign In for Pricing
View Details
Recombinant Human P4HB Protein, N-His
HY517022-02 100 µg

Recombinant Human P4HB Protein, N-His

Sign In for Pricing
View Details
Recombinant Human P4HB Protein, N-His
HY517022-03 1 mg

Recombinant Human P4HB Protein, N-His

Sign In for Pricing
View Details
Human 8-iso prostaglandin F2α (8-iso-PGF2α)
QY-E05963 96 Tests

Human 8-iso prostaglandin F2α (8-iso-PGF2α)

Sign In for Pricing
View Details
SENP5 (Sentrin-specific Protease 5, Sentrin/SUMO-specific Protease SENP5, SUMO1/sentrin Specific Peptidase 5, DKFZp564O1016, FKSG45, FLJ42398, MGC27076) (Biotin)
MBS6144270-01 0.1 mL

SENP5 (Sentrin-specific Protease 5, Sentrin/SUMO-specific Protease SENP5, SUMO1/sentrin Specific Peptidase 5, DKFZp564O1016, FKSG45, FLJ42398, MGC27076) (Biotin)

Sign In for Pricing
View Details
SENP5 (Sentrin-specific Protease 5, Sentrin/SUMO-specific Protease SENP5, SUMO1/sentrin Specific Peptidase 5, DKFZp564O1016, FKSG45, FLJ42398, MGC27076) (Biotin)
MBS6144270-02 5x 0.1 mL

SENP5 (Sentrin-specific Protease 5, Sentrin/SUMO-specific Protease SENP5, SUMO1/sentrin Specific Peptidase 5, DKFZp564O1016, FKSG45, FLJ42398, MGC27076) (Biotin)

Sign In for Pricing
View Details