Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Y-box-binding protein 1 (Ybx1)

Recombinant Mouse Y-box-binding protein 1 (Ybx1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ybx1. Target Synonyms: CCAAT-binding transcription factor I subunit A; CBF-ADNA-binding protein B; DBPBEnhancer factor I subunit A; EFI-AY-box transcription factorY-box-binding protein 1; YB-1. Accession Number: P62960. Expression Region: 2~322aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 37.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Y-box-binding protein 1 (Ybx1) is a purified Recombinant Protein.

Accession Number

P62960

Expression Region

2~322aa

Host

Yeast

Target

Ybx1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

37.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CCAAT-binding transcription factor I subunit A; CBF-ADNA-binding protein B; DBPBEnhancer factor I subunit A; EFI-AY-box transcription factorY-box-binding protein 1; YB-1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Myostatin (MSTN)
MBS2112132-01 0.1 mL

Polyclonal Antibody to Myostatin (MSTN)

Sign In for Pricing
View Details
Polyclonal Antibody to Myostatin (MSTN)
MBS2112132-02 0.2 mL

Polyclonal Antibody to Myostatin (MSTN)

Sign In for Pricing
View Details
Polyclonal Antibody to Myostatin (MSTN)
MBS2112132-03 0.5 mL

Polyclonal Antibody to Myostatin (MSTN)

Sign In for Pricing
View Details
Polyclonal Antibody to Myostatin (MSTN)
MBS2112132-04 1 mL

Polyclonal Antibody to Myostatin (MSTN)

Sign In for Pricing
View Details
Polyclonal Antibody to Myostatin (MSTN)
MBS2112132-05 5 mL

Polyclonal Antibody to Myostatin (MSTN)

Sign In for Pricing
View Details
Polyclonal Antibody to Myostatin (MSTN)
MBS2112132-06 5x 5 mL

Polyclonal Antibody to Myostatin (MSTN)

Sign In for Pricing
View Details