Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Serum amyloid A protein (SAA1), partial

Recombinant Cat Serum amyloid A protein (SAA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Felis catus (Cat) (Felis silvestris catus) . Target Name: SAA1. Target Synonyms: Amyloid fibril protein AACurated. Accession Number: P19707. Expression Region: 1~90aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 12.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Cat Serum amyloid A protein (SAA1), partial is a purified Recombinant Protein.

Accession Number

P19707

Expression Region

1~90aa

Host

Yeast

Target

SAA1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Amyloid fibril protein AACurated

Species

Cat (Felis catus; Felis silvestris catus)

Protein Name

Recombinant Protein

AA Sequence

EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eapp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
18852116 3x 1.0 µg

Eapp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ARIH1 Lentiviral Activation Particles (h)
sc-407954-LAC 200 µL

ARIH1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Sheep Anti Single Stranded DNA ELISA kit
GTR10419053 96 Well

Sheep Anti Single Stranded DNA ELISA kit

Sign In for Pricing
View Details
Mito-Tracker Deep Red 633
C1034-250μg 250 µg

Mito-Tracker Deep Red 633

Sign In for Pricing
View Details
REG1A (Regenerating Islet-Derived 1 alpha, ICRF, MGC12447, P19, PSP, PSPS, PSPS1, PTP, REG) (AP)
MBS6165682-01 0.1 mL

REG1A (Regenerating Islet-Derived 1 alpha, ICRF, MGC12447, P19, PSP, PSPS, PSPS1, PTP, REG) (AP)

Sign In for Pricing
View Details
REG1A (Regenerating Islet-Derived 1 alpha, ICRF, MGC12447, P19, PSP, PSPS, PSPS1, PTP, REG) (AP)
MBS6165682-02 5x 0.1 mL

REG1A (Regenerating Islet-Derived 1 alpha, ICRF, MGC12447, P19, PSP, PSPS, PSPS1, PTP, REG) (AP)

Sign In for Pricing
View Details