Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PTPRB. Target Synonyms: Vascular endothelial protein tyrosine phosphataseVE-PTP. Accession Number: P23467. Expression Region: 1643~1997aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 43.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial is a purified Recombinant Protein.

Accession Number

P23467

Expression Region

1643~1997aa

Host

Yeast

Target

PTPRB

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Cytoplasmic Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

43.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Vascular endothelial protein tyrosine phosphataseVE-PTP

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RXFP3/RLN3R1/SALPR Antibody [mFluor Violet 450 SE]
NBP2-97628MFV450 0.1 mL

Rabbit Polyclonal RXFP3/RLN3R1/SALPR Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Mouse Double-stranded RNA-specific editase 1, Adarb1 ELISA KIT
ELI-18224m 96 Tests

Mouse Double-stranded RNA-specific editase 1, Adarb1 ELISA KIT

Sign In for Pricing
View Details
Card9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3696605 3x 1.0 µg

Card9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PTPN9 Antibody
E30AOC350 100 µL

PTPN9 Antibody

Sign In for Pricing
View Details
Mitra Orchid Medium w/ Vitamins & Sucrose; w/o Agar
PT106-5L 5 L

Mitra Orchid Medium w/ Vitamins & Sucrose; w/o Agar

Sign In for Pricing
View Details
PQLC1 (SLC66A2) (NM_001146345) Human Tagged ORF Clone Lentiviral Particle
RC228186L3V 200 µL

PQLC1 (SLC66A2) (NM_001146345) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details