Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Anionic trypsin-1 (Prss1)

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Prss1. Target Synonyms: Anionic trypsin IPretrypsinogen ISerine protease 1. Accession Number: P00762. Expression Region: 24–246aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein.

Accession Number

P00762

Expression Region

24–246aa

Host

Yeast

Target

Prss1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Anionic trypsin IPretrypsinogen ISerine protease 1

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D1, CT (Ubiquitin-conjugating Enzyme E2-D1, Ubiquitin-protein Ligase D1, Ubiquitin Carrier Protein D1, UbcH5, Ubiquitin-conjugating Enzyme E2-17kD 1, Ubiquitin-conjugating Enzyme E2 (17) KB 1, UBC4/5 Homolog, Stimulator of Fe Transport, SFT, SFT, UBC5A, UBCH5, UBCH5A) (FITC) discontinued
U1000-86M-FITC 200 µL

UBE2D1, CT (Ubiquitin-conjugating Enzyme E2-D1, Ubiquitin-protein Ligase D1, Ubiquitin Carrier Protein D1, UbcH5, Ubiquitin-conjugating Enzyme E2-17kD 1, Ubiquitin-conjugating Enzyme E2 (17) KB 1, UBC4/5 Homolog, Stimulator of Fe Transport, SFT, SFT, UBC5A, UBCH5, UBCH5A) (FITC) discontinued

Sign In for Pricing
View Details
CD18 ITGB2 Rabbit Monoclonal Antibody
orb547328 100 µL

CD18 ITGB2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Porcine Tyrosine ELISA Kit
GTR10325642 96 Well

Porcine Tyrosine ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Abcc1 shRNA (UAS) - Lentiviral mouse Abcc1 shRNA (UAS, RFP) plasmid
GTR15190117 1 Vial

Lentiviral mouse Abcc1 shRNA (UAS) - Lentiviral mouse Abcc1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
N-Glycolylneuraminic Acid
sc-202234E 5 g

N-Glycolylneuraminic Acid

Sign In for Pricing
View Details
Rabbit Anti Human ADORA2A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,Immunofluorescence) 200UL
IRBAMLADORA2AAP57200UL 200 µL

Rabbit Anti Human ADORA2A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,Immunofluorescence) 200UL

Sign In for Pricing
View Details