Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O157:H7 Peptide deformylase (def)

Recombinant E. coli O157:H7 Peptide deformylase (def) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: def. Target Synonyms: Polypeptide deformylase. Accession Number: P0A6K5. Expression Region: 2~169aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O157:H7 Peptide deformylase (def) is a purified Recombinant Protein.

Accession Number

P0A6K5

Expression Region

2~169aa

Host

Yeast

Target

Def

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Polypeptide deformylase

Species

E. coli O157:H7

Protein Name

Recombinant Protein

AA Sequence

SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas Aeruginosa purC Protein (aa 1-236) (strain LESB58)
VAng-Cr0626-500gEcoli 500 µg (E. coli)

Recombinant Pseudomonas Aeruginosa purC Protein (aa 1-236) (strain LESB58)

Sign In for Pricing
View Details
LAIR1 (NM_002287) Human Recombinant Protein
TP306439 20 µg

LAIR1 (NM_002287) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Monoclonal FCAR/CD89 Antibody (14A8 (14.1)) [FITC] - Chimeric
NBP3-20161F 0.1 mL

Rabbit Monoclonal FCAR/CD89 Antibody (14A8 (14.1)) [FITC] - Chimeric

Sign In for Pricing
View Details
MDM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]
TA804615BM 100 µL

MDM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]

Sign In for Pricing
View Details
Trpc1 Mouse shRNA Lentiviral Particle (Locus ID 22063)
TL502329V 500 µL Each

Trpc1 Mouse shRNA Lentiviral Particle (Locus ID 22063)

Sign In for Pricing
View Details
SARS-CoV-2 - nucleocapsid protein - 48.3 kDa
orb762378 1 mg

SARS-CoV-2 - nucleocapsid protein - 48.3 kDa

Sign In for Pricing
View Details