Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ms4a1. Target Synonyms: B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20. Accession Number: P19437. Expression Region: 132~291aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 20.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial is a purified Recombinant Protein.

Accession Number

P19437

Expression Region

132~291aa

Host

Yeast

Target

Ms4a1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Membrane attack complex inhibition factor (MACIF/CD59) ELISA Kit
MBS2613852-01 48 Well

Porcine Membrane attack complex inhibition factor (MACIF/CD59) ELISA Kit

Sign In for Pricing
View Details
Porcine Membrane attack complex inhibition factor (MACIF/CD59) ELISA Kit
MBS2613852-02 96 Well

Porcine Membrane attack complex inhibition factor (MACIF/CD59) ELISA Kit

Sign In for Pricing
View Details
Porcine Membrane attack complex inhibition factor (MACIF/CD59) ELISA Kit
MBS2613852-03 5x 96 Well

Porcine Membrane attack complex inhibition factor (MACIF/CD59) ELISA Kit

Sign In for Pricing
View Details
Porcine Membrane attack complex inhibition factor (MACIF/CD59) ELISA Kit
MBS2613852-04 10x 96 Well

Porcine Membrane attack complex inhibition factor (MACIF/CD59) ELISA Kit

Sign In for Pricing
View Details
VAMP3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
49417064 1.0 µg DNA

VAMP3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-CCL16 antibody
STJ117512 100 µl

Anti-CCL16 antibody

Sign In for Pricing
View Details