Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18 (Il18)

Recombinant Mouse Interleukin-18 (Il18) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Il18. Target Synonyms: Interferon gamma-inducing factor. Accession Number: P70380. Expression Region: 1~192aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 24.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Interleukin-18 (Il18) is a purified Recombinant Protein.

Accession Number

P70380

Expression Region

1~192aa

Host

Yeast

Target

Il18

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interferon gamma-inducing factor

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLOCK Rabbit mAb
E45R11800N 50 ul

CLOCK Rabbit mAb

Sign In for Pricing
View Details
Msx3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7021408 1.0 µg DNA

Msx3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Sheep Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit
MBS9916828-01 48 Well

Sheep Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit

Sign In for Pricing
View Details
Sheep Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit
MBS9916828-02 96 Well

Sheep Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit

Sign In for Pricing
View Details
Sheep Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit
MBS9916828-03 5x 96 Well

Sheep Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit

Sign In for Pricing
View Details
Sheep Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit
MBS9916828-04 10x 96 Well

Sheep Protein Phosphatase 2, Catalytic Subunit, Beta Isoform (PPP2CB) ELISA Kit

Sign In for Pricing
View Details