Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-glucagon (GCG), partial

Recombinant Human Pro-glucagon (GCG), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GCG. Target Synonyms: Incretin hormoneGlucagon-like peptide 1 (7-37) ; GLP-1 (7-37) Glucagon-like peptide 1 (7-36) ; GLP-1 (7-36) Glucagon-like peptide 2; GLP-2. Accession Number: P01275. Expression Region: 53~89aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 6.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Pro-glucagon (GCG), partial is a purified Recombinant Protein.

Accession Number

P01275

Expression Region

53~89aa

Host

Yeast

Target

GCG

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

6.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Incretin hormoneGlucagon-like peptide 1 (7-37) ; GLP-1 (7-37) Glucagon-like peptide 1 (7-36) ; GLP-1 (7-36) Glucagon-like peptide 2; GLP-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOST, NT (SOST, Sclerostin) (APC)
MBS6349860-01 0.2 mL

SOST, NT (SOST, Sclerostin) (APC)

Sign In for Pricing
View Details
SOST, NT (SOST, Sclerostin) (APC)
MBS6349860-02 5x 0.2 mL

SOST, NT (SOST, Sclerostin) (APC)

Sign In for Pricing
View Details
PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 650)
MBS6389897-01 0.1 mL

PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 650)

Sign In for Pricing
View Details
PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 650)
MBS6389897-02 5x 0.1 mL

PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 650)

Sign In for Pricing
View Details
TLR4 Antibody (Biotin)
GWB-2E44E4 0.05 mg

TLR4 Antibody (Biotin)

Sign In for Pricing
View Details
Methyl 4- (aminomethyl) -5-methylthiophene-2-carboxylate hydrochloride
TMD05915-01 50 mg

Methyl 4- (aminomethyl) -5-methylthiophene-2-carboxylate hydrochloride

Sign In for Pricing
View Details