Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitamin D-binding protein (GC), partial

Recombinant Human Vitamin D-binding protein (GC), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GC. Target Synonyms: Gc protein-derived macrophage activating factor. Accession Number: P02774. Expression Region: 19~474aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 67kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Vitamin D-binding protein (GC), partial is a purified Recombinant Protein.

Accession Number

P02774

Expression Region

19~474aa

Host

Yeast

Target

GC

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumostar-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial of NM_000583.3

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

67kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Gc protein-derived macrophage activating factor

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-CD80 Recombinant Monoclonal Antibody [BLR237K]
MBS3906603-01 0.01 mL

Rabbit anti-CD80 Recombinant Monoclonal Antibody [BLR237K]

Sign In for Pricing
View Details
Rabbit anti-CD80 Recombinant Monoclonal Antibody [BLR237K]
MBS3906603-02 0.1 mL

Rabbit anti-CD80 Recombinant Monoclonal Antibody [BLR237K]

Sign In for Pricing
View Details
Rabbit anti-CD80 Recombinant Monoclonal Antibody [BLR237K]
MBS3906603-03 5x 0.01 mL

Rabbit anti-CD80 Recombinant Monoclonal Antibody [BLR237K]

Sign In for Pricing
View Details
Rabbit anti-CD80 Recombinant Monoclonal Antibody [BLR237K]
MBS3906603-04 5x 0.1 mL

Rabbit anti-CD80 Recombinant Monoclonal Antibody [BLR237K]

Sign In for Pricing
View Details
Fibronectin/Ugl-Y3 Rabbit Polyclonal Antibody (Biotin)
orb454476 100 µL

Fibronectin/Ugl-Y3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal PUM2 Antibody [DyLight 680]
NBP2-97161FR 0.1 mL

Rabbit Polyclonal PUM2 Antibody [DyLight 680]

Sign In for Pricing
View Details