Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial

Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COL18A1. Target Synonyms: Alpha 1 collagen type 18 (XVIII; COL18A1) ; Alpha 1 type XVIII collagen; Antiangiogenic agent; COIA1_HUMAN; COL15A1; Col18a1; Collagen alpha 1 (XV) chain; Collagen alpha 1 (XVIII) chain; Collagen alpha-1 (XV) chain. Accession Number: P39060. Expression Region: 1578~1754aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial is a purified Recombinant Protein.

Accession Number

P39060

Expression Region

1578~1754aa

Host

Yeast

Target

COL18A1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Adhesion

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Alpha 1 collagen type 18 (XVIII; COL18A1) ; Alpha 1 type XVIII collagen; Antiangiogenic agent; COIA1_HUMAN; COL15A1; Col18a1; Collagen alpha 1 (XV) chain; Collagen alpha 1 (XVIII) chain; Collagen alpha-1 (XV) chain; Collagen type XV proteoglycan; Collagen type XVIII alpha 1; Collagen XV; alpha 1 polypeptide; Collagen; type XV; alpha 1; Endostatin; Endostatin XV; FLJ27325; FLJ34914; FLJ38566; KNO; KNO1; KS; MGC74745; Multi functional protein MFP; OTTHUMP00000021782; OTTHUMP00000115472; OTTHUMP00000115473

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OGFR (NM_007346) Human Recombinant Protein
PH35798M5 20 µg

OGFR (NM_007346) Human Recombinant Protein

Sign In for Pricing
View Details
Human hsa-miR-4743-3p miRNA Agomir
abx881938-01 5 nmol

Human hsa-miR-4743-3p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-4743-3p miRNA Agomir
abx881938-02 10 nmol

Human hsa-miR-4743-3p miRNA Agomir

Sign In for Pricing
View Details
Tau (T181) Antibody
KC-1515-01 50 μL

Tau (T181) Antibody

Sign In for Pricing
View Details
Tau (T181) Antibody
KC-1515-02 100 µL

Tau (T181) Antibody

Sign In for Pricing
View Details
Tau (T181) Antibody
KC-1515-03 1 mL

Tau (T181) Antibody

Sign In for Pricing
View Details