Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD59 glycoprotein (CD59)

Recombinant Human CD59 glycoprotein (CD59) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD59. Target Synonyms: 1F5 antigen20 kDa homologous restriction factor; HRF-20; HRF20MAC-inhibitory protein; MAC-IPMEM43 antigen; Membrane attack complex inhibition factor; MACIFMembrane inhibitor of reactive lysis; MIRLProtectin; CD59. Accession Number: P13987. Expression Region: 26~102aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 11kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human CD59 glycoprotein (CD59) is a purified Recombinant Protein.

Accession Number

P13987

Expression Region

26~102aa

Host

Yeast

Target

CD59

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1F5 antigen20 kDa homologous restriction factor; HRF-20; HRF20MAC-inhibitory protein; MAC-IPMEM43 antigen; Membrane attack complex inhibition factor; MACIFMembrane inhibitor of reactive lysis; MIRLProtectin; CD59

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody [Clone ID: OTI8D6]
TA802118 100 µL

PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody [Clone ID: OTI8D6]

Sign In for Pricing
View Details
TUBA1B antibody
70R-21056 50 μL

TUBA1B antibody

Sign In for Pricing
View Details
UPIIIa (C-6) Alexa Fluor® 647
sc-166808 AF647 200 µg/mL

UPIIIa (C-6) Alexa Fluor® 647

Sign In for Pricing
View Details
FBL8 Lentiviral Activation Particles (m)
sc-424501-LAC 200 µL

FBL8 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
C2orf83-set siRNA/shRNA/RNAi Lentivector (Human)
14441091 4x 500 ng

C2orf83-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Recombinant COVID-19 NSP2 protein, C-His tag
IMP-858 10 µg

Recombinant COVID-19 NSP2 protein, C-His tag

Sign In for Pricing
View Details