Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD59 glycoprotein (CD59)

Recombinant Human CD59 glycoprotein (CD59) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD59. Target Synonyms: 1F5 antigen20 kDa homologous restriction factor; HRF-20; HRF20MAC-inhibitory protein; MAC-IPMEM43 antigen; Membrane attack complex inhibition factor; MACIFMembrane inhibitor of reactive lysis; MIRLProtectin; CD59. Accession Number: P13987. Expression Region: 26~102aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 11kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human CD59 glycoprotein (CD59) is a purified Recombinant Protein.

Accession Number

P13987

Expression Region

26~102aa

Host

Yeast

Target

CD59

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1F5 antigen20 kDa homologous restriction factor; HRF-20; HRF20MAC-inhibitory protein; MAC-IPMEM43 antigen; Membrane attack complex inhibition factor; MACIFMembrane inhibitor of reactive lysis; MIRLProtectin; CD59

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Bcl-6 Antibody (SPM602) [Allophycocyanin]
NBP3-08851APC 100 µL

Mouse Monoclonal Bcl-6 Antibody (SPM602) [Allophycocyanin]

Sign In for Pricing
View Details
Rabbit Monoclonal Napsin A Antibody (NAPSA/1865R) [DyLight 680]
NBP3-08379FR 100 µL

Rabbit Monoclonal Napsin A Antibody (NAPSA/1865R) [DyLight 680]

Sign In for Pricing
View Details
CHSY2 shRNA Plasmid (h)
sc-60381-SH 20 µg

CHSY2 shRNA Plasmid (h)

Sign In for Pricing
View Details
DDX6 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
17860124 3x 1.0µg DNA

DDX6 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Poly A Binding Protein Cytoplasmic 1 (PABPC1) Magnetic Fluorescence Assay Kit
MBS2160796-01 96 Tests

Poly A Binding Protein Cytoplasmic 1 (PABPC1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Poly A Binding Protein Cytoplasmic 1 (PABPC1) Magnetic Fluorescence Assay Kit
MBS2160796-02 5x 96 Tests

Poly A Binding Protein Cytoplasmic 1 (PABPC1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details