Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD59 glycoprotein (CD59)

Recombinant Human CD59 glycoprotein (CD59) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD59. Target Synonyms: 1F5 antigen20 kDa homologous restriction factor; HRF-20; HRF20MAC-inhibitory protein; MAC-IPMEM43 antigen; Membrane attack complex inhibition factor; MACIFMembrane inhibitor of reactive lysis; MIRLProtectin; CD59. Accession Number: P13987. Expression Region: 26~102aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 11kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human CD59 glycoprotein (CD59) is a purified Recombinant Protein.

Accession Number

P13987

Expression Region

26~102aa

Host

Yeast

Target

CD59

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1F5 antigen20 kDa homologous restriction factor; HRF-20; HRF20MAC-inhibitory protein; MAC-IPMEM43 antigen; Membrane attack complex inhibition factor; MACIFMembrane inhibitor of reactive lysis; MIRLProtectin; CD59

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam209 Mouse Gene Knockout Kit (CRISPR)
KN505636 1 Kit

Fam209 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Histidine, hydrochloride
HB0330 100g

L-Histidine, hydrochloride

Sign In for Pricing
View Details
Carboxypeptidase E (CPE) Bovine ELISA Kit
C1359 96 Tests

Carboxypeptidase E (CPE) Bovine ELISA Kit

Sign In for Pricing
View Details
Anti-IGF2 (DX-2647)
A2945-1mg 1 mg

Anti-IGF2 (DX-2647)

Sign In for Pricing
View Details
Human V-set and immunoglobulin domain-containing protein 4, VSIG4 ELISA Kit
MBS925833-01 24 Well (LIMIT 1)

Human V-set and immunoglobulin domain-containing protein 4, VSIG4 ELISA Kit

Sign In for Pricing
View Details
Human V-set and immunoglobulin domain-containing protein 4, VSIG4 ELISA Kit
MBS925833-02 48 Well

Human V-set and immunoglobulin domain-containing protein 4, VSIG4 ELISA Kit

Sign In for Pricing
View Details