Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aspartoacylase (ASPA)

Recombinant Human Aspartoacylase (ASPA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ASPA. Target Synonyms: Aminoacylase-2ACY2, ASP. Accession Number: P45381. Expression Region: 1~313aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 39.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Aspartoacylase (ASPA) is a purified Recombinant Protein.

Accession Number

P45381

Expression Region

1~313aa

Host

Yeast

Target

ASPA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aminoacylase-2ACY2, ASP

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpress™ Human EBP Over-expressing Stable Cell Line
ABC-X0929 1 Vial

Xpress™ Human EBP Over-expressing Stable Cell Line

Sign In for Pricing
View Details
IFluor® 555 goat anti-mouse IgG (H+L) *Cross Adsorbed*
16540-AAT 200 µg

IFluor® 555 goat anti-mouse IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details
KCNAB3 (NM_004732) Human 3' UTR Clone
SC205281 10 µg

KCNAB3 (NM_004732) Human 3' UTR Clone

Sign In for Pricing
View Details
DNA Damage Inducible Transcript 3 (DDIT3) Antibody
abx405122-01 100 µL

DNA Damage Inducible Transcript 3 (DDIT3) Antibody

Sign In for Pricing
View Details
DNA Damage Inducible Transcript 3 (DDIT3) Antibody
abx405122-02 200 µL

DNA Damage Inducible Transcript 3 (DDIT3) Antibody

Sign In for Pricing
View Details
DNA Damage Inducible Transcript 3 (DDIT3) Antibody
abx405122-03 1 mL

DNA Damage Inducible Transcript 3 (DDIT3) Antibody

Sign In for Pricing
View Details