Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Apolipoprotein C-III (APOC3)

Recombinant Macaca fascicularis Apolipoprotein C-III (APOC3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: APOC3. Target Synonyms: Apolipoprotein C3. Accession Number: P18659. Expression Region: 21~99aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 24.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Macaca fascicularis Apolipoprotein C-III (APOC3) is a purified Recombinant Protein.

Accession Number

P18659

Expression Region

21~99aa

Host

Yeast

Target

APOC3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumostar-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Apolipoprotein C3

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Recombinant Protein

AA Sequence

SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS12P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV782957 1.0 µg DNA

RPS12P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ACSM1, NT (ACSM1, BUCS1, LAE, MACS1, Acyl-coenzyme A synthetase ACSM1, mitochondrial, Acyl-CoA synthetase medium-chain family member 1, Butyrate-CoA ligase 1, Butyryl-coenzyme A synthetase 1, Lipoate-activating enzyme, Middle-chain acyl-CoA synthetase 1)
MBS6271141-01 0.1 mL

ACSM1, NT (ACSM1, BUCS1, LAE, MACS1, Acyl-coenzyme A synthetase ACSM1, mitochondrial, Acyl-CoA synthetase medium-chain family member 1, Butyrate-CoA ligase 1, Butyryl-coenzyme A synthetase 1, Lipoate-activating enzyme, Middle-chain acyl-CoA synthetase 1)

Sign In for Pricing
View Details
ACSM1, NT (ACSM1, BUCS1, LAE, MACS1, Acyl-coenzyme A synthetase ACSM1, mitochondrial, Acyl-CoA synthetase medium-chain family member 1, Butyrate-CoA ligase 1, Butyryl-coenzyme A synthetase 1, Lipoate-activating enzyme, Middle-chain acyl-CoA synthetase 1)
MBS6271141-02 5x 0.1 mL

ACSM1, NT (ACSM1, BUCS1, LAE, MACS1, Acyl-coenzyme A synthetase ACSM1, mitochondrial, Acyl-CoA synthetase medium-chain family member 1, Butyrate-CoA ligase 1, Butyryl-coenzyme A synthetase 1, Lipoate-activating enzyme, Middle-chain acyl-CoA synthetase 1)

Sign In for Pricing
View Details
α-Skeletal Muscle Actin Polyclonal Antibody
RA12201-01 50 µL

α-Skeletal Muscle Actin Polyclonal Antibody

Sign In for Pricing
View Details
α-Skeletal Muscle Actin Polyclonal Antibody
RA12201-02 100 µL

α-Skeletal Muscle Actin Polyclonal Antibody

Sign In for Pricing
View Details
Rat Nup210l Pre-designed siRNA Set B
SI209665B 1 Each

Rat Nup210l Pre-designed siRNA Set B

Sign In for Pricing
View Details