Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Thioredoxin-1 (trxA)

Recombinant E. coli Thioredoxin-1 (trxA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: trxA. Target Synonyms: trxA; fipA; tsnC; b3781; JW5856; Thioredoxin 1; Trx-1. Accession Number: P0AA25. Expression Region: 2~109aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 15.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Thioredoxin-1 (trxA) is a purified Recombinant Protein.

Accession Number

P0AA25

Expression Region

2~109aa

Host

E. coli

Target

TrxA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TrxA; fipA; tsnC; b3781; JW5856; Thioredoxin 1; Trx-1

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complete Medium for Mouse Gastric Mucosal Epithelial Cells
abx704157-01 100 mL

Complete Medium for Mouse Gastric Mucosal Epithelial Cells

Sign In for Pricing
View Details
Complete Medium for Mouse Gastric Mucosal Epithelial Cells
abx704157-02 500 mL

Complete Medium for Mouse Gastric Mucosal Epithelial Cells

Sign In for Pricing
View Details
NADK2 Rabbit Monoclonal Antibody
E56G0758 100 µL

NADK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant VSIV G protein/Glycoprotein G Protein, C-Strep
AP97137 50 µg

Recombinant VSIV G protein/Glycoprotein G Protein, C-Strep

Sign In for Pricing
View Details
PCDHB5 Rabbit pAb, Pacific Blue conjugated
orb2863192 100 µL

PCDHB5 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
pAAV-CMV-FGF2-6×His Plasmid
PVT52200 2 µg

pAAV-CMV-FGF2-6×His Plasmid

Sign In for Pricing
View Details