Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18-binding protein (Il18bp)

Recombinant Mouse Interleukin-18-binding protein (Il18bp) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Il18bp. Target Synonyms: Interferon gamma-inducing factor-binding protein. Accession Number: Q9Z0M9. Expression Region: 29~193aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Interleukin-18-binding protein (Il18bp) is a purified Recombinant Protein.

Accession Number

Q9Z0M9

Expression Region

29~193aa

Host

E. coli

Target

Il18bp

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interferon gamma-inducing factor-binding protein

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anaphase Promoting Complex Subunit 1 (ANAPC1) Antibody
abx211523-01 50 µL

Anaphase Promoting Complex Subunit 1 (ANAPC1) Antibody

Sign In for Pricing
View Details
Anaphase Promoting Complex Subunit 1 (ANAPC1) Antibody
abx211523-02 100 µL

Anaphase Promoting Complex Subunit 1 (ANAPC1) Antibody

Sign In for Pricing
View Details
Recombinant Human Rap2A Protein
NBP1-50939-0.05mg 0.05 mg

Recombinant Human Rap2A Protein

Sign In for Pricing
View Details
Human FBXO28 activation kit by CRISPRa
GA108136 1 Kit

Human FBXO28 activation kit by CRISPRa

Sign In for Pricing
View Details
Eribulin Mesylate Impurity 8
RM-E180208-01 10 mg

Eribulin Mesylate Impurity 8

Sign In for Pricing
View Details
Eribulin Mesylate Impurity 8
RM-E180208-02 25 mg

Eribulin Mesylate Impurity 8

Sign In for Pricing
View Details