Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Brain-derived neurotrophic factor (Bdnf), partial

Recombinant Rat Brain-derived neurotrophic factor (Bdnf), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Bdnf. Target Synonyms: BdnfBrain-derived neurotrophic factor; BDNF; Cleaved into: BDNF precursor form; ProBDNF. Accession Number: P23363. Expression Region: 136~243aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Brain-derived neurotrophic factor (Bdnf), partial is a purified Recombinant Protein.

Accession Number

P23363

Expression Region

136~243aa

Host

E. coli

Target

Bdnf

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BdnfBrain-derived neurotrophic factor; BDNF; Cleaved into: BDNF precursor form; ProBDNF

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL38 Antibody, Biotin conjugated
A37233-50UG 50 µg

RPL38 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial
MBS1313290-01 0.5 mg (E-Coli)

Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial

Sign In for Pricing
View Details
Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial
MBS1313290-02 0.05 mg (Baculovirus)

Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial

Sign In for Pricing
View Details
Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial
MBS1313290-03 0.5 mg (Yeast)

Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial

Sign In for Pricing
View Details
Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial
MBS1313290-04 0.05 mg (Mammalian-Cell)

Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial

Sign In for Pricing
View Details
Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial
MBS1313290-05 1 mg (E-Coli)

Recombinant Human SLIT and NTRK-like protein 1 (SLITRK1), partial

Sign In for Pricing
View Details