Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1), partial

Recombinant Human HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HLA-DPA1. Target Synonyms: DP (W3) DP (W4) HLA-SB alpha chain; MHC class II DP3-alphaMHC class II DPA1. Accession Number: P20036. Expression Region: 29~222aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1), partial is a purified Recombinant Protein.

Accession Number

P20036

Expression Region

29~222aa

Host

E. coli

Target

HLA-DPA1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DP (W3) DP (W4) HLA-SB alpha chain; MHC class II DP3-alphaMHC class II DPA1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NECAB1 Recombinant Protein (Rat)
RP213608 100 µg

NECAB1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Hspa5 ORF Vector (Mouse) (pORF)
ORF047543 1.0 µg DNA

Hspa5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Nitratiruptor sp. Ribonuclease P protein component (rnpA)
MBS1219702-01 0.02 mg (E-Coli)

Recombinant Nitratiruptor sp. Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Nitratiruptor sp. Ribonuclease P protein component (rnpA)
MBS1219702-02 0.1 mg (E-Coli)

Recombinant Nitratiruptor sp. Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Nitratiruptor sp. Ribonuclease P protein component (rnpA)
MBS1219702-03 0.02 mg (Yeast)

Recombinant Nitratiruptor sp. Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Nitratiruptor sp. Ribonuclease P protein component (rnpA)
MBS1219702-04 0.1 mg (Yeast)

Recombinant Nitratiruptor sp. Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details