Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1), partial

Recombinant Human HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HLA-DPA1. Target Synonyms: DP (W3) DP (W4) HLA-SB alpha chain; MHC class II DP3-alphaMHC class II DPA1. Accession Number: P20036. Expression Region: 29~222aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1), partial is a purified Recombinant Protein.

Accession Number

P20036

Expression Region

29~222aa

Host

E. coli

Target

HLA-DPA1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DP (W3) DP (W4) HLA-SB alpha chain; MHC class II DP3-alphaMHC class II DPA1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL13RA1 (C-Term) Rabbit pAb
MBS8556096-01 0.1 mL

IL13RA1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
IL13RA1 (C-Term) Rabbit pAb
MBS8556096-02 0.1 mL (AF405L)

IL13RA1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
IL13RA1 (C-Term) Rabbit pAb
MBS8556096-03 0.1 mL (AF405S)

IL13RA1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
IL13RA1 (C-Term) Rabbit pAb
MBS8556096-04 0.1 mL (AF610)

IL13RA1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
IL13RA1 (C-Term) Rabbit pAb
MBS8556096-05 0.1 mL (AF635)

IL13RA1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
IL13RA1 (C-Term) Rabbit pAb
MBS8556096-06 0.1 mL (APC)

IL13RA1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details