Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-like protein ISG15 (Isg15)

Recombinant Human Ubiquitin-like protein ISG15 (Isg15) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Isg15. Target Synonyms: Interferon-induced 15 kDa proteinInterferon-induced 17 kDa protein; IP17Ubiquitin cross-reactive protein. Accession Number: P05161. Expression Region: 2~157aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 44.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ubiquitin-like protein ISG15 (Isg15) is a purified Recombinant Protein.

Accession Number

P05161

Expression Region

2~157aa

Host

E. coli

Target

Isg15

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interferon-induced 15 kDa proteinInterferon-induced 17 kDa protein; IP17Ubiquitin cross-reactive protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 9 (1D1)  monoclonal antibody
MB3050 50ul

Caspase 9 (1D1) monoclonal antibody

Sign In for Pricing
View Details
Phenol 5 Comp Mix Std 2000ug/mL in DCM
REPHE046 1 mL

Phenol 5 Comp Mix Std 2000ug/mL in DCM

Sign In for Pricing
View Details
Human GPR 139 (GPR139) (NM_001002911) AAV Particle
RC219456A1V 250 µL

Human GPR 139 (GPR139) (NM_001002911) AAV Particle

Sign In for Pricing
View Details
GPR12 Human Recombinant Protein, Synthetic Nanodisc
TP721658 10 µg

GPR12 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Influenza A (H3N2) Antigen Liquid
MBS8431005-01 1 mL

Influenza A (H3N2) Antigen Liquid

Sign In for Pricing
View Details
Influenza A (H3N2) Antigen Liquid
MBS8431005-02 5x 1 mL

Influenza A (H3N2) Antigen Liquid

Sign In for Pricing
View Details