Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-like protein ISG15 (Isg15)

Recombinant Human Ubiquitin-like protein ISG15 (Isg15) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Isg15. Target Synonyms: Interferon-induced 15 kDa proteinInterferon-induced 17 kDa protein; IP17Ubiquitin cross-reactive protein. Accession Number: P05161. Expression Region: 2~157aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 44.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ubiquitin-like protein ISG15 (Isg15) is a purified Recombinant Protein.

Accession Number

P05161

Expression Region

2~157aa

Host

E. coli

Target

Isg15

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interferon-induced 15 kDa proteinInterferon-induced 17 kDa protein; IP17Ubiquitin cross-reactive protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ryanodine Receptor 1
333262-01 50 µg

Ryanodine Receptor 1

Sign In for Pricing
View Details
Ryanodine Receptor 1
333262-02 100 µg

Ryanodine Receptor 1

Sign In for Pricing
View Details
High Temperature Requirement Factor A1 (HTRA1), Recombinant, E.coli, His-Tag
056808-01 10 µg

High Temperature Requirement Factor A1 (HTRA1), Recombinant, E.coli, His-Tag

Sign In for Pricing
View Details
High Temperature Requirement Factor A1 (HTRA1), Recombinant, E.coli, His-Tag
056808-02 50 µg

High Temperature Requirement Factor A1 (HTRA1), Recombinant, E.coli, His-Tag

Sign In for Pricing
View Details
High Temperature Requirement Factor A1 (HTRA1), Recombinant, E.coli, His-Tag
056808-03 100 µg

High Temperature Requirement Factor A1 (HTRA1), Recombinant, E.coli, His-Tag

Sign In for Pricing
View Details
High Temperature Requirement Factor A1 (HTRA1), Recombinant, E.coli, His-Tag
056808-04 200 µg

High Temperature Requirement Factor A1 (HTRA1), Recombinant, E.coli, His-Tag

Sign In for Pricing
View Details