Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-like protein ISG15 (Isg15)

Recombinant Human Ubiquitin-like protein ISG15 (Isg15) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Isg15. Target Synonyms: Interferon-induced 15 kDa proteinInterferon-induced 17 kDa protein; IP17Ubiquitin cross-reactive protein. Accession Number: P05161. Expression Region: 2~157aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 44.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ubiquitin-like protein ISG15 (Isg15) is a purified Recombinant Protein.

Accession Number

P05161

Expression Region

2~157aa

Host

E. coli

Target

Isg15

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interferon-induced 15 kDa proteinInterferon-induced 17 kDa protein; IP17Ubiquitin cross-reactive protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Centrin 1 (CETN1) (NM_004066) Human Tagged ORF Clone Lentiviral Particle
RC206285L3V 200 µL

Centrin 1 (CETN1) (NM_004066) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TCEA2 Recombinant Protein (Human)
RP031114 100 µg

TCEA2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Hsa-miR-4660 agomir
HY-R01216A-01 5 nmol

Hsa-miR-4660 agomir

Sign In for Pricing
View Details
Hsa-miR-4660 agomir
HY-R01216A-02 20 nmol

Hsa-miR-4660 agomir

Sign In for Pricing
View Details
Mouse Hemoglobin subunit beta (HBB) ELISA Kit
MBS2806233-01 48 Tests

Mouse Hemoglobin subunit beta (HBB) ELISA Kit

Sign In for Pricing
View Details
Mouse Hemoglobin subunit beta (HBB) ELISA Kit
MBS2806233-02 96 Tests

Mouse Hemoglobin subunit beta (HBB) ELISA Kit

Sign In for Pricing
View Details