Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-synuclein (SNCA), partial

Recombinant Human Alpha-synuclein (SNCA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SNCA. Target Synonyms: Non-A beta component of AD amyloidNon-A4 component of amyloid precursor; NACP. Accession Number: P37840. Expression Region: 1~139AA. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 41.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Alpha-synuclein (SNCA), partial is a purified Recombinant Protein.

Accession Number

P37840

Expression Region

1~139AA

Host

E. coli

Target

SNCA

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Non-A beta component of AD amyloidNon-A4 component of amyloid precursor; NACP

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GADD45A, 1-165aa, Human, His tag, E.coli
E53A02177 50 µg

GADD45A, 1-165aa, Human, His tag, E.coli

Sign In for Pricing
View Details
RGS17 Rabbit Polyclonal Antibody (Biotin)
orb454115 100 µL

RGS17 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Centromeric histone H3-like protein-2 Antibody, PE Conjugated
bs-0621R-PE 100 µL

Centromeric histone H3-like protein-2 Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Ribose transport system permease protein rbsC (rbsC)
orb2910077-01 20 µg

Recombinant Ribose transport system permease protein rbsC (rbsC)

Sign In for Pricing
View Details
Recombinant Ribose transport system permease protein rbsC (rbsC)
orb2910077-02 100 µg

Recombinant Ribose transport system permease protein rbsC (rbsC)

Sign In for Pricing
View Details
Asic2 (NM_001034013) Mouse Tagged ORF Clone Lentiviral Particle
MR221087L4V 200 µL

Asic2 (NM_001034013) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details